PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10008300m
Common NameCARUB_v10008300mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Nin-like
Protein Properties Length: 845aa    MW: 94033.8 Da    PI: 5.1413
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10008300mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.94.9e-29556606252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Carubv10008300m 556 DKTITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 606
                      689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.154540626IPR003035RWP-RK domain
PfamPF020423.3E-25558606IPR003035RWP-RK domain
SuperFamilySSF542772.26E-22735831No hitNo description
SMARTSM006667.7E-26744827IPR000270PB1 domain
PROSITE profilePS5174528.503744827IPR000270PB1 domain
CDDcd064071.82E-41745825No hitNo description
Gene3DG3DSA:3.10.20.2408.3E-21745824No hitNo description
PfamPF005641.1E-19745826IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 845 aa     Download sequence    Send to blast
MEDSFLQTEN AVMDSEFMDG LLLDGCWLET TDGSEFLNVA PSTSSVSPFD PSSFMWSPTQ  60
DTSAICTSGV VSTMYGQDCV ERSSLDDFQW NKRWWIGPGG GGSVTERLVQ AVEHIKDYTT  120
ERGSLIQLWV PVNRGGKRVL TTKEQPFSHD PMCQRLANYR EISVNYHFSA EQDDSKALAG  180
LPGRVFLGKL PEWTPDVRFF KSEEYPRVHH AQDCGVRGTL AIPVFEQGSK ICLGVIEVVM  240
TTEMVKLRPE LESICKALQA VDLRSTELPI PASLTGCDLS YKAALPEIRN LLRCACETHK  300
LPLAQTWVSC LQQNKSGCRH NDENYIHCVS TIEDACYVGD PTVREFHEAC SEHHLLKGQG  360
VAGQAFMTNG PCFSSDVSNY KKSEYPLSHH ANMYGLHGAV AIRLRCIHTG SADFVLEFFL  420
PKDCDDLEEQ RKMLNALSTI MAHVPRSLRT VTDKELEEES VVIEREDIVT PKIENASELQ  480
HLHDNSPWSA SLEEIQSNNT SNSQNLGLVF DGDKPNDGFG LKRGFDYTMD SNVNESGTFS  540
SGGFSMMAEK KRTKADKTIT LDVLRQYFAG SLKDAAKNIG VCPTTLKRIC RQHGIQRWPS  600
RKIKKVGHSL QKIQRVIDSV QGVSGPLPIG SFYANFPNLV SQSQEPSQQA KTSPPPPPPV  660
QLAKSPVSSY SQSSNSSQCC SSETQLNSGA TTDPASADVG GLLKKTSSEI ELQSSSLDET  720
ILTLSSLENV PQGTNLISSQ DDDFLRIKVS YGEEKIRLRM RNSRKLTDLL WEIGKRFSIE  780
DMSRYDLKYL DEDNEWVLLT CDEDVEECVD VCRTTPSQTI KLLLQVSSHQ FPERSSATEY  840
SLWH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
GenBankAY1172370.0AY117237.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306759.10.0hypothetical protein CARUB_v10008300mg
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLR0GUM30.0R0GUM3_9BRAS; Uncharacterized protein
STRINGAT1G20640.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein